PNC-27 – 5mg

$144.99

10 People recently viewed this product and 2 people have it in their cart!
Order Today and Get The Items Shipped By: July 29

80 in stock

Quantity Fixed price
2 - 9 $141.99
10 - 19 $138.99
20 + $135.99
Bulk pricing will be applied to package:

PNC-27 is a synthetically created peptide designed to specifically target and destroy cancer cells. It is a member of the PNC set of investigational proteins designed to attach to malformed (cancerous) cells and cause them to die through cell necrosis, all while leaving normal, healthy cells intact and unharmed.

The PNC-27 peptide contains an HDM-2 binding domain corresponding to residues 12-26 of p53 and a transmembrane-penetrating domain. This has been found to enable the peptide to bind to and kill cancer cells through membranolysis, or disruption of the cell membrane.

Through research and study on animal subjects, the PNC-27 peptide has been shown to be highly effective in selectively targeting a wide variety of specific forms of cancer, including pancreatic cancer, breast cancer, leukemia, melanoma, and additional cancer lines.

Important Information About This Research Product:

  1. Your vials are not empty. The product is at the bottom of the vial.
  2. All peptides come in a lyophilized (freeze-dried) powder, that must be reconstituted with bacteriostatic water (this is not something that we carry).
  3. Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.
  4. All products purchased are for laboratory & research use ONLY, this means we cannot provide any further instructions on reconstitution and/or dosing.

1159861-00-3

Lyophilized Powder

PNC-27

PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

C188H293N53O44S

418.407 g/mol

Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.

Etiam nulla nunc, aliquet vel metus nec, scelerisque tempus enim. Sed eget blandit lectus. Donec facilisis ornare turpis id pretium. Maecenas scelerisque interdum dolor in vestibulum. Proin euismod dui purus, non lacinia ligula luctus. Lorem ipsum dolor sit amet.

Lorem ipsum dolor sit amet, consectetur adipiscing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. Ut enim ad minim veniam, quis nostrud exercitation ullamco laboris nisi ut aliquip ex ea commodo consequat. Duis aute irure dolor in reprehenderit in voluptate velit esse cillum dolore eu fugiat nulla pariatur. Excepteur sint occaecat cupidatat non proident, sunt in culpa
qui officia deserunt mollit anim id est laborum.

Sign-Up Today and Save!

Sign up to receive your exclusive discount, and keep up to date on our latest products & offers!

Weight .284 oz

1159861-00-3

Lyophilized Powder

PNC-27

PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

C188H293N53O44S

418.407 g/mol

Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.

Description

Etiam nulla nunc, aliquet vel metus nec, scelerisque tempus enim. Sed eget blandit lectus. Donec facilisis ornare turpis id pretium. Maecenas scelerisque interdum dolor in vestibulum. Proin euismod dui purus, non lacinia ligula luctus. Lorem ipsum dolor sit amet.

Lorem ipsum dolor sit amet, consectetur adipiscing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. Ut enim ad minim veniam, quis nostrud exercitation ullamco laboris nisi ut aliquip ex ea commodo consequat. Duis aute irure dolor in reprehenderit in voluptate velit esse cillum dolore eu fugiat nulla pariatur. Excepteur sint occaecat cupidatat non proident, sunt in culpa
qui officia deserunt mollit anim id est laborum.

Additional information

Weight .284 oz

1 review for PNC-27 – 5mg

  1. Isabella L.

    It works, 5 stars👍🏻

Add a review

Your email address will not be published. Required fields are marked